Recombinant Human ADPRH Protein, GST-tagged
Cat.No. : | ADPRH-374H |
Product Overview : | Human ADPRH full-length ORF ( NP_001116.1, 1 a.a. - 357 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The enzyme encoded by this gene catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-ribosylation cycle. Unlike the rat and mouse enzymes that require DTT for maximal activity, the human enzyme is DTT-independent. Alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq, May 2014] |
Molecular Mass : | 65.9 kDa |
AA Sequence : | MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADPRH ADP-ribosylarginine hydrolase [ Homo sapiens ] |
Official Symbol | ADPRH |
Synonyms | ADPRH; ADP-ribosylarginine hydrolase; [Protein ADP-ribosylarginine] hydrolase; ARH1; ADP-ribose-L-arginine cleaving enzyme; |
Gene ID | 141 |
mRNA Refseq | NM_001125 |
Protein Refseq | NP_001116 |
MIM | 603081 |
UniProt ID | P54922 |
◆ Recombinant Proteins | ||
ADPRH-973HF | Recombinant Full Length Human ADPRH Protein, GST-tagged | +Inquiry |
ADPRH-5743H | Recombinant Human ADPRH protein, His-tagged | +Inquiry |
ADPRH-374H | Recombinant Human ADPRH Protein, GST-tagged | +Inquiry |
ADPRH-256R | Recombinant Rhesus monkey ADPRH Protein, His-tagged | +Inquiry |
ADPRH-2063H | Recombinant Human ADP-ribosylarginine Hydrolase, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADPRH-9003HCL | Recombinant Human ADPRH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADPRH Products
Required fields are marked with *
My Review for All ADPRH Products
Required fields are marked with *
0
Inquiry Basket