Recombinant Human ADPRH Protein, GST-tagged

• Cat.No.: ADPRH-374H
• Product Overview: Human ADPRH full-length ORF ( NP_001116.1, 1 a.a. - 357 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The enzyme encoded by this gene catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-ribosylation cycle. Unlike the rat and mouse enzymes that require DTT for maximal activity, the human enzyme is DTT-independent. Alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq, May 2014]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 65.9 kDa
• AA Sequence: MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADPRH ADP-ribosylarginine hydrolase [ Homo sapiens ]
• Official Symbol: ADPRH
• Synonyms: ADPRH; ADP-ribosylarginine hydrolase; [Protein ADP-ribosylarginine] hydrolase; ARH1; ADP-ribose-L-arginine cleaving enzyme
• Gene ID: 141
• mRNA Refseq: NM_001125
• Protein Refseq: NP_001116
• MIM: 603081
• UniProt ID: P54922