Recombinant Human ADORA2A protein, GST-tagged

• Cat.No.: ADORA2A-318H
• Product Overview: Recombinant Human ADORA2A protein(NP_000666)(300-412 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 300-412 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: RKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
• Concentration: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ADORA2A adenosine A2a receptor [ Homo sapiens ]
• Official Symbol: ADORA2A
• Synonyms: ADORA2A; adenosine A2a receptor; ADORA2; adenosine receptor A2a; RDC8; adenosine A2 receptor; adenosine receptor subtype A2a; hA2aR
• Gene ID: 135
• mRNA Refseq: NM_000675
• Protein Refseq: NP_000666
• MIM: 102776
• UniProt ID: P29274