Recombinant Human ADIRF Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ADIRF-3309H
Product Overview : C10orf116 MS Standard C13 and N15-labeled recombinant protein (NP_006820) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : APM2 gene is exclusively expressed in adipose tissue. Its function is currently unknown.
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 7.9 kDa
AA Sequence : MASKGLQDLKQQVEGTAQEAVSAAGAAAQQVVDQATEAGQKAMDQLAKTTQETIDKTANQASDTFSGIGKKFGLLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ADIRF adipogenesis regulatory factor [ Homo sapiens (human) ]
Official Symbol ADIRF
Synonyms ADIRF; adipogenesis regulatory factor; AFRO; APM2; apM-2; C10orf116; adipogenesis regulatory factor; adipogenesis factor rich in obesity; adipose most abundant gene transcript 2 protein; adipose specific 2; adipose-specific protein 2
Gene ID 10974
mRNA Refseq NM_006829
Protein Refseq NP_006820
UniProt ID Q15847

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ADIRF Products

Required fields are marked with *

My Review for All ADIRF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon