Recombinant Human ADGRV1 protein, GST-tagged
Cat.No. : | ADGRV1-5643H |
Product Overview : | Recombinant Human ADGRV1 protein(2269-2812 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sars-CoV-2 |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2269-2812 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | ESIIVSLVYTEGGSRILPSSDTVRVNILANDNVAGIVSFQTASRSVIGHEGEILQFHVIRTFPGRGNVTVNWKIIGQNLELNFANFSGQLFFPEGSLNTTLFVHLLDDNIPEEKEVYQVILYDVRTQGVPPAGIALLDAQGYAA |
◆ Recombinant Proteins | ||
ADGRV1-5643H | Recombinant Human ADGRV1 protein, GST-tagged | +Inquiry |
NSP15-592V | Recombinant COVID-19 NSP15 protein, His-tagged | +Inquiry |
NSP15-594V | Recombinant COVID-19 NSP15 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NSP15 Products
Required fields are marked with *
My Review for All NSP15 Products
Required fields are marked with *
0
Inquiry Basket