Recombinant Human ADGRG5 protein, T7/His-tagged

• Cat.No.: ADGRG5-177H
• Product Overview: Recombinant human GPR114 extracellular domain cDNA (22 - 250 aa, derived from BC032401) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&T7
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEETWEELLSYMENMQVSRGRSSVFSSRQLHQLEQMLLNTSFPGYNLTL QTPTIQSLAFKLSCDFSGLSLTSATLKRVPQAGGQHARGQHAMQFPAELTRDACKTRPRELRLICIYFSNTHFFK DENNSSLLNNYVLGAQLSHGHVNNLRDPVNISFWHNQSLEGYTLTCVFWKEGARKQPWGGWSPEGCRTEQPSHSQ VLCRCNHLTYFAVLMQLSPALVPAELLAPLTY
• Purity: >90% by SDS-PAGE.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
• Protein length: 22-250 a.a.

Gene Information

• Gene Name: ADGRG5 adhesion G protein-coupled receptor G5 [ Homo sapiens ]
• Official Symbol: ADGRG5
• Synonyms: PGR27; GPR114; G protein-coupled receptor 114; G protein-coupled receptor PGR27
• Gene ID: 221188
• mRNA Refseq: NM_001304376
• Protein Refseq: NP_001291305
• UniProt ID: Q8IZF4
• Chromosome Location: 16q21
• Function: G-protein coupled receptor activity