Recombinant Human ADCY5 Protein, GST-tagged
Cat.No. : | ADCY5-329H |
Product Overview : | Human ADCY5 partial ORF ( NP_899200, 1152 a.a. - 1261 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the membrane-bound adenylyl cyclase enzymes. Adenylyl cyclases mediate G protein-coupled receptor signaling through the synthesis of the second messenger cAMP. Activity of the encoded protein is stimulated by the Gs alpha subunit of G protein-coupled receptors and is inhibited by protein kinase A, calcium and Gi alpha subunits. Single nucleotide polymorphisms in this gene may be associated with low birth weight and type 2 diabetes. Alternatively spliced transcript variants that encode different isoforms have been observed for this gene. [provided by RefSeq, Dec 2010] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | ADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPLS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADCY5 adenylate cyclase 5 [ Homo sapiens ] |
Official Symbol | ADCY5 |
Synonyms | ADCY5; adenylate cyclase 5; adenylate cyclase type 5; AC5; adenylyl cyclase 5; adenylate cyclase type V; ATP pyrophosphate-lyase 5; |
Gene ID | 111 |
mRNA Refseq | NM_001199642 |
Protein Refseq | NP_001186571 |
MIM | 600293 |
UniProt ID | O95622 |
◆ Recombinant Proteins | ||
Adcy5-3177M | Recombinant Mouse Adcy5, GST-tagged | +Inquiry |
ADCY5-518R | Recombinant Rat ADCY5 Protein | +Inquiry |
ADCY5-6927H | Recombinant Human ADCY5 protein, His & T7-tagged | +Inquiry |
ADCY5-3176R | Recombinant Rabbit ADCY5, GST-tagged | +Inquiry |
ADCY5-7665Z | Recombinant Zebrafish ADCY5 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADCY5 Products
Required fields are marked with *
My Review for All ADCY5 Products
Required fields are marked with *
0
Inquiry Basket