Recombinant Human ADCY5 Protein, GST-tagged

• Cat.No.: ADCY5-329H
• Product Overview: Human ADCY5 partial ORF ( NP_899200, 1152 a.a. - 1261 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the membrane-bound adenylyl cyclase enzymes. Adenylyl cyclases mediate G protein-coupled receptor signaling through the synthesis of the second messenger cAMP. Activity of the encoded protein is stimulated by the Gs alpha subunit of G protein-coupled receptors and is inhibited by protein kinase A, calcium and Gi alpha subunits. Single nucleotide polymorphisms in this gene may be associated with low birth weight and type 2 diabetes. Alternatively spliced transcript variants that encode different isoforms have been observed for this gene. [provided by RefSeq, Dec 2010]
• Molecular Mass: 37.84 kDa
• AA Sequence: ADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPLS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADCY5 adenylate cyclase 5 [ Homo sapiens ]
• Official Symbol: ADCY5
• Synonyms: ADCY5; adenylate cyclase 5; adenylate cyclase type 5; AC5; adenylyl cyclase 5; adenylate cyclase type V; ATP pyrophosphate-lyase 5
• Gene ID: 111
• mRNA Refseq: NM_001199642
• Protein Refseq: NP_001186571
• MIM: 600293
• UniProt ID: O95622