Recombinant Human ADCK2 Protein, GST-tagged
Cat.No. : | ADCK2-323H |
Product Overview : | Human ADCK2 partial ORF ( AAH14107.1, 2 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ADCK2 (AarF Domain Containing Kinase 2) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein serine/threonine kinase activity. |
Molecular Mass : | 35.53 kDa |
AA Sequence : | VAPWRVSVRVCLSHLRCFELRQGLSLLRPSECPRDARLCWLLLGTLPKVVSLCGDVGEGAPDVLSRRRVRCSGAAGAGPAESLPRAGPL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADCK2 aarF domain containing kinase 2 [ Homo sapiens ] |
Official Symbol | ADCK2 |
Synonyms | ADCK2; aarF domain containing kinase 2; uncharacterized aarF domain-containing protein kinase 2; MGC20727; putative ubiquinone biosynthesis protein AarF; AARF; |
Gene ID | 90956 |
mRNA Refseq | NM_052853 |
Protein Refseq | NP_443085 |
UniProt ID | Q7Z695 |
◆ Recombinant Proteins | ||
ADCK2-1049M | Recombinant Mouse ADCK2 Protein (200-609 aa), His-SUMO-tagged | +Inquiry |
ADCK2-323H | Recombinant Human ADCK2 Protein, GST-tagged | +Inquiry |
RFL26479HF | Recombinant Full Length Human Uncharacterized Aarf Domain-Containing Protein Kinase 2(Adck2) Protein, His-Tagged | +Inquiry |
ADCK2-1681M | Recombinant Mouse ADCK2 Protein, His-tagged | +Inquiry |
ADCK2-903HF | Recombinant Full Length Human ADCK2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADCK2-9023HCL | Recombinant Human ADCK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADCK2 Products
Required fields are marked with *
My Review for All ADCK2 Products
Required fields are marked with *
0
Inquiry Basket