Recombinant Human ADCK2 Protein, GST-tagged

Cat.No. : ADCK2-323H
Product Overview : Human ADCK2 partial ORF ( AAH14107.1, 2 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ADCK2 (AarF Domain Containing Kinase 2) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein serine/threonine kinase activity.
Molecular Mass : 35.53 kDa
AA Sequence : VAPWRVSVRVCLSHLRCFELRQGLSLLRPSECPRDARLCWLLLGTLPKVVSLCGDVGEGAPDVLSRRRVRCSGAAGAGPAESLPRAGPL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADCK2 aarF domain containing kinase 2 [ Homo sapiens ]
Official Symbol ADCK2
Synonyms ADCK2; aarF domain containing kinase 2; uncharacterized aarF domain-containing protein kinase 2; MGC20727; putative ubiquinone biosynthesis protein AarF; AARF;
Gene ID 90956
mRNA Refseq NM_052853
Protein Refseq NP_443085
UniProt ID Q7Z695

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ADCK2 Products

Required fields are marked with *

My Review for All ADCK2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon