Recombinant Human ADCK2 Protein, GST-tagged

• Cat.No.: ADCK2-323H
• Product Overview: Human ADCK2 partial ORF ( AAH14107.1, 2 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ADCK2 (AarF Domain Containing Kinase 2) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein serine/threonine kinase activity.
• Molecular Mass: 35.53 kDa
• AA Sequence: VAPWRVSVRVCLSHLRCFELRQGLSLLRPSECPRDARLCWLLLGTLPKVVSLCGDVGEGAPDVLSRRRVRCSGAAGAGPAESLPRAGPL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADCK2 aarF domain containing kinase 2 [ Homo sapiens ]
• Official Symbol: ADCK2
• Synonyms: ADCK2; aarF domain containing kinase 2; uncharacterized aarF domain-containing protein kinase 2; MGC20727; putative ubiquinone biosynthesis protein AarF; AARF
• Gene ID: 90956
• mRNA Refseq: NM_052853
• Protein Refseq: NP_443085
• UniProt ID: Q7Z695