Recombinant Human ADAT1 Protein, GST-tagged

• Cat.No.: ADAT1-317H
• Product Overview: Human ADAT1 full-length ORF ( AAH02758.1, 1 a.a. - 502 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is a member of the ADAR (adenosine deaminase acting on RNA) family. Using site-specific adenosine modification, proteins encoded by these genes participate in the pre-mRNA editing of nuclear transcripts. The protein encoded by this gene, tRNA-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic tRNA. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2010]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 81.8 kDa
• AA Sequence: MWTADEIAQLCYEHYGIRLPKKGKPEPNHEWTLLAAVVKIQSPADKACDTPDKPVQVTKEVVSMGTGTKCIGQSKMRKNGDILNDSHAEVIARRSFQRYLLHQLQLAATLKEDSIFVPGTQKGVWKLRRDLIFVFFSSHTPCGDASIIPMLEFEDQPCCPVFRNWAHNSSVEASSNLEAPGNERKCEDPDSPVTKKMRLEPGTAAREVTNGAAHHQSFGKQKSGPISPGIHSCDLTVEGLATVTRIAPGSAKVIDVYRTGAKCVPGEAGDSGKPGAAFHQVGLLRVKPGRGDRTRSMSCSDKMARWNVLGCQGALLMHLLEEPIYLSAVVIGKCPYSQEAMQRALIGRCQNVSALPKGFGVQELKILQSDLLFEQSRSAVQAKRADSPGRLVPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQVFGSWIRNPPDYHQFK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADAT1 adenosine deaminase, tRNA-specific 1 [ Homo sapiens ]
• Official Symbol: ADAT1
• Synonyms: ADAT1; adenosine deaminase, tRNA-specific 1; tRNA-specific adenosine deaminase 1; adenosine deaminase acting on tRNA; tRNA-specific adenosine-37 deaminase; HADAT1
• Gene ID: 23536
• mRNA Refseq: NM_012091
• Protein Refseq: NP_036223
• MIM: 604230
• UniProt ID: Q9BUB4