Recombinant Human ADAMTSL3 Protein, GST-tagged

Cat.No. : ADAMTSL3-312H
Product Overview : Human ADAMTSL3 partial ORF ( NP_997400.1, 1591 a.a. - 1691 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ADAMTSL3 (ADAMTS Like 3) is a Protein Coding gene. Among its related pathways are O-glycosylation of TSR domain-containing proteins and HIV Life Cycle. GO annotations related to this gene include peptidase activity and metallopeptidase activity. An important paralog of this gene is ADAMTSL1.
Molecular Mass : 36.85 kDa
AA Sequence : NCTSGACDVCWHTGPWKPCTAACGRGFQSRKVDCIHTRSCKPVAKRHCVQKKKPISWRHCLGPSCDRDCTDTTHYCMFVKHLNLCSLDRYKQRCCQSCQEG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADAMTSL3 ADAMTS-like 3 [ Homo sapiens ]
Official Symbol ADAMTSL3
Synonyms ADAMTSL3; ADAMTS-like 3; ADAMTS-like protein 3; KIAA1233; punctin 2; ADAMTSL-3; punctin-2; a disintegrin-like and metalloprotease domain with thrombospondin type I motifs-like 3; MGC150716; MGC150717;
Gene ID 57188
mRNA Refseq NM_207517
Protein Refseq NP_997400
MIM 609199
UniProt ID P82987

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ADAMTSL3 Products

Required fields are marked with *

My Review for All ADAMTSL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon