Recombinant Human ADAMTSL3 Protein, GST-tagged

• Cat.No.: ADAMTSL3-312H
• Product Overview: Human ADAMTSL3 partial ORF ( NP_997400.1, 1591 a.a. - 1691 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ADAMTSL3 (ADAMTS Like 3) is a Protein Coding gene. Among its related pathways are O-glycosylation of TSR domain-containing proteins and HIV Life Cycle. GO annotations related to this gene include peptidase activity and metallopeptidase activity. An important paralog of this gene is ADAMTSL1.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.85 kDa
• AA Sequence: NCTSGACDVCWHTGPWKPCTAACGRGFQSRKVDCIHTRSCKPVAKRHCVQKKKPISWRHCLGPSCDRDCTDTTHYCMFVKHLNLCSLDRYKQRCCQSCQEG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADAMTSL3 ADAMTS-like 3 [ Homo sapiens ]
• Official Symbol: ADAMTSL3
• Synonyms: ADAMTSL3; ADAMTS-like 3; ADAMTS-like protein 3; KIAA1233; punctin 2; ADAMTSL-3; punctin-2; a disintegrin-like and metalloprotease domain with thrombospondin type I motifs-like 3; MGC150716; MGC150717
• Gene ID: 57188
• mRNA Refseq: NM_207517
• Protein Refseq: NP_997400
• MIM: 609199
• UniProt ID: P82987