Recombinant Human ADAMTSL3 Protein, GST-tagged
Cat.No. : | ADAMTSL3-312H |
Product Overview : | Human ADAMTSL3 partial ORF ( NP_997400.1, 1591 a.a. - 1691 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | ADAMTSL3 (ADAMTS Like 3) is a Protein Coding gene. Among its related pathways are O-glycosylation of TSR domain-containing proteins and HIV Life Cycle. GO annotations related to this gene include peptidase activity and metallopeptidase activity. An important paralog of this gene is ADAMTSL1. |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 36.85 kDa |
AA Sequence : | NCTSGACDVCWHTGPWKPCTAACGRGFQSRKVDCIHTRSCKPVAKRHCVQKKKPISWRHCLGPSCDRDCTDTTHYCMFVKHLNLCSLDRYKQRCCQSCQEG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADAMTSL3 ADAMTS-like 3 [ Homo sapiens ] |
Official Symbol | ADAMTSL3 |
Synonyms | ADAMTSL3; ADAMTS-like 3; ADAMTS-like protein 3; KIAA1233; punctin 2; ADAMTSL-3; punctin-2; a disintegrin-like and metalloprotease domain with thrombospondin type I motifs-like 3; MGC150716; MGC150717; |
Gene ID | 57188 |
mRNA Refseq | NM_207517 |
Protein Refseq | NP_997400 |
MIM | 609199 |
UniProt ID | P82987 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAMTSL3 Products
Required fields are marked with *
My Review for All ADAMTSL3 Products
Required fields are marked with *
0
Inquiry Basket