Recombinant Human ADAMTSL1 protein, His-tagged

• Cat.No.: ADAMTSL1-3833H
• Product Overview: Recombinant Human ADAMTSL1 protein(1-355 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-His
• Protein length: 1-355 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: MECCRRATPGTLLLFLAFLLLSSRTARSEEDRDGLWDAWGPWSECSRTCGGGASYSLRRCLSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKHHGQFYEWLPVSNDPDNPCSLKCQAKGTTLVVELAPKVLDGTRCYTESLDMCISGLCQIVGCDHQLGSTVKEDNCGVCNGDGSTCRLVRGQYKSQLSATKSDDTVVAIPYGSRHIRLVLKGPDHLYLETKTLQGTKGENSLSSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIRNSGSADSTVQFIFYQPIIHRWRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPKLQECN
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: ADAMTSL1 ADAMTS-like 1 [ Homo sapiens ]
• Official Symbol: ADAMTSL1
• Synonyms: ADAMTSL1; ADAMTS-like 1; C9orf94, chromosome 9 open reading frame 94; ADAMTS-like protein 1; ADAMTSR1; FLJ35283; punctin; punctin-1; ADAM-TS related protein 1; C9orf94; PUNCTIN; ADAMTSL-1; FLJ41032; FLJ46891; MGC40193; MGC118803; MGC118805; DKFZp686L03130
• Gene ID: 92949
• mRNA Refseq: NM_001040272
• Protein Refseq: NP_001035362
• MIM: 609198
• UniProt ID: Q8N6G6