Recombinant Human ADAMTSL1 protein, His-tagged
Cat.No. : | ADAMTSL1-3833H |
Product Overview : | Recombinant Human ADAMTSL1 protein(1-355 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-355 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MECCRRATPGTLLLFLAFLLLSSRTARSEEDRDGLWDAWGPWSECSRTCGGGASYSLRRCLSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKHHGQFYEWLPVSNDPDNPCSLKCQAKGTTLVVELAPKVLDGTRCYTESLDMCISGLCQIVGCDHQLGSTVKEDNCGVCNGDGSTCRLVRGQYKSQLSATKSDDTVVAIPYGSRHIRLVLKGPDHLYLETKTLQGTKGENSLSSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIRNSGSADSTVQFIFYQPIIHRWRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPKLQECN |
Gene Name | ADAMTSL1 ADAMTS-like 1 [ Homo sapiens ] |
Official Symbol | ADAMTSL1 |
Synonyms | ADAMTSL1; ADAMTS-like 1; C9orf94, chromosome 9 open reading frame 94; ADAMTS-like protein 1; ADAMTSR1; FLJ35283; punctin; punctin-1; ADAM-TS related protein 1; C9orf94; PUNCTIN; ADAMTSL-1; FLJ41032; FLJ46891; MGC40193; MGC118803; MGC118805; DKFZp686L03130; |
Gene ID | 92949 |
mRNA Refseq | NM_001040272 |
Protein Refseq | NP_001035362 |
MIM | 609198 |
UniProt ID | Q8N6G6 |
◆ Recombinant Proteins | ||
AMTN-9627H | Recombinant Human AMTN, GST-tagged | +Inquiry |
ADAMTSL1-3833H | Recombinant Human ADAMTSL1 protein, His-tagged | +Inquiry |
AMTN-221H | Recombinant Human AMTN protein(Met1-Gln209), mFc-tagged | +Inquiry |
AMTN-661R | Recombinant Rat AMTN Protein | +Inquiry |
AMTN-1317HF | Recombinant Full Length Human AMTN Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMTN-001HCL | Recombinant Human AMTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AMTN Products
Required fields are marked with *
My Review for All AMTN Products
Required fields are marked with *
0
Inquiry Basket