Recombinant Human ADAMTS14 protein, His-tagged

Cat.No. : ADAMTS14-654H
Product Overview : Recombinant Human ADAMTS14 protein(Q8WXS8)(253-555aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 253-555a.a.
Tag : His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 40.2 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : HAKPGSYSIEVLLVVDDSVVRFHGKEHVQNYVLTLMNIVDEIYHDESLGVHINIALVRLIMVGYRQSLSLIERGNPSRSLEQVCRWAHSQQRQDPSHAEHHDHVVFLTRQDFGPSGYAPVTGMCHPLRSCALNHEDGFSSAFVIAHETGHVLGMEHDGQGNGCADETSLGSVMAPLVQAAFHRFHWSRCSKLELSRYLPSYDCLLDDPFDPAWPQPPELPGINYSMDEQCRFDFGSGYQTCLAFRTFEPCKQLWCSHPDNPYFCKTKKGPPLDGTECAPGKWCFKGHCIWKSPEQTYGQDGGW
Gene Name ADAMTS14 ADAM metallopeptidase with thrombospondin type 1 motif, 14 [ Homo sapiens ]
Official Symbol ADAMTS14
Synonyms ADAMTS14; ADAM metallopeptidase with thrombospondin type 1 motif, 14; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 14; A disintegrin and metalloproteinase with thrombospondin motifs 14; ADAM-TS14; ADAMTS-14; ADAM-TS 14; metalloprotease-disintegrin protease; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 14; FLJ32820;
Gene ID 140766
mRNA Refseq NM_080722
Protein Refseq NP_542453
MIM 607506
UniProt ID Q8WXS8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ADAMTS14 Products

Required fields are marked with *

My Review for All ADAMTS14 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon