Recombinant Human ADAMDEC1 Protein, GST-tagged

• Cat.No.: ADAMDEC1-294H
• Product Overview: Human ADAMDEC1 partial ORF ( NP_055294, 361 a.a. - 470 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their interactions with germinal center T cells. [provided by RefSeq, Jul 2008]
• Molecular Mass: 37.84 kDa
• AA Sequence: PDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADAMDEC1 ADAM-like, decysin 1 [ Homo sapiens ]
• Official Symbol: ADAMDEC1
• Synonyms: ADAMDEC1; ADAM-like, decysin 1; ADAM DEC1; M12.219; decysin; disintegrin protease; ADAM-like protein decysin-1; a disintegrin and metalloproteinase domain-like protein decysin-1; FLJ79219
• Gene ID: 27299
• mRNA Refseq: NM_001145271
• Protein Refseq: NP_001138743
• MIM: 606393
• UniProt ID: O15204