Recombinant Human ADAM8 protein, GST-tagged

• Cat.No.: ADAM8-3622H
• Product Overview: Recombinant Human ADAM8 protein(17-198 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-GST
• Protein length: 17-198 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: IAPSRPWALMEQYEVVLPRRLPGPRVRRALPSHLGLHPERVSYVLGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGYPDSAASLSTCAGLRGFFQVGSDLHLIEPLDEGGEGGRHAVYQAEHLLQTAGTCGVSDDSLGSLLGPRTAAVFRPRPGDSLPSRE
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: ADAM8 ADAM metallopeptidase domain 8 [ Homo sapiens ]
• Official Symbol: ADAM8
• Synonyms: ADAM8; ADAM metallopeptidase domain 8; a disintegrin and metalloproteinase domain 8; disintegrin and metalloproteinase domain-containing protein 8; CD156; MS2; cell surface antigen MS2; human leukocyte differentiation antigen; MGC134985
• Gene ID: 101
• mRNA Refseq: NM_001109
• Protein Refseq: NP_001100
• MIM: 602267
• UniProt ID: P78325