Recombinant Human ADAM33 Protein, GST-tagged

• Cat.No.: ADAM33-289H
• Product Overview: Human ADAM33 full-length ORF ( AAH62663.1, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This protein is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2013]
• Molecular Mass: 35.8 kDa
• AA Sequence: MGWRPRRARGTPLLLLLLLLLLWPVPGAGVLQGHIPGQPVTPHWVLDGQPWRTVSLEEPVSKPDMGLVALEAEGQELLLELEKNQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADAM33 ADAM metallopeptidase domain 33 [ Homo sapiens ]
• Official Symbol: ADAM33
• Synonyms: ADAM33; ADAM metallopeptidase domain 33; a disintegrin and metalloproteinase domain 33 , C20orf153, chromosome 20 open reading frame 153; disintegrin and metalloproteinase domain-containing protein 33; dJ964F7.1; DKFZp434K0521; ADAM 33; a disintegrin and metalloprotease 33; a disintegrin and metalloproteinase domain 33; disintegrin and reprolysin metalloproteinase family protein; C20orf153; DJ964F7.1; FLJ35308; FLJ36751; MGC71889; MGC149823
• Gene ID: 80332
• mRNA Refseq: NM_025220
• Protein Refseq: NP_079496
• MIM: 607114
• UniProt ID: Q9BZ11