Recombinant Human ADAM15 Protein (207-452 aa), GST-tagged

• Cat.No.: ADAM15-1186H
• Product Overview: Recombinant Human ADAM15 Protein (207-452 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cancer. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 207-452 aa
• Description: Active metalloproteinase with gelatinolytic and collagenolytic activity. Plays a role in the wound healing process. Mediates both heterotypic intraepithelial cell/T-cell interactions and homotypic T-cell aggregation. Inhibits beta-1 integrin-mediated cell adhesion and migration of airway smooth muscle cells. Suppresses cell motility on or towards fibronectin possibly by driving alpha-v/beta-1 integrin (ITAGV-ITGB1) cell surface expression via ERK1/2 inactivation. Cleaves E-cadherin in response to growth factor deprivation. Plays a role in glomerular cell migration. Plays a role in pathological neovascularization. May play a role in cartilage rodeling. May be proteolytically processed, during sperm epididymal maturation and the acrosome reaction. May play a role in sperm-egg binding through its disintegrin domain.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 53.6 kDa
• AA Sequence: DVVTETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDSAQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDLPGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPMAAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLT
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: ADAM15 ADAM metallopeptidase domain 15 [ Homo sapiens ]
• Official Symbol: ADAM15
• Synonyms: ADAM15; MDC15; metargidin; MDC-15; ADAM 15
• Gene ID: 8751
• mRNA Refseq: NM_003815
• Protein Refseq: NP_003806
• MIM: 605548
• UniProt ID: Q13444