Recombinant Human ACTRT1 Protein, GST-tagged

• Cat.No.: ACTRT1-243H
• Product Overview: Human ACTRT1 partial ORF ( NP_612146.1, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein related to the cytoskeletal protein beta-actin. This protein is a major component of the calyx in the perinuclear theca of mammalian sperm heads, and it therefore likely functions in spermatid formation. This gene is intronless and is similar to a related gene located on chromosome 1. A related pseudogene has also been identified approximately 75 kb downstream of this gene on chromosome X. [provided by RefSeq, May 2010]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: MFNPHALDVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQKYFVGQEALYKYEALHLHYPIERGLVTGWDDMEKLWKHLFERELGVK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACTRT1 actin-related protein T1 [ Homo sapiens ]
• Official Symbol: ACTRT1
• Synonyms: ACTRT1; actin-related protein T1; AIP1; ARIP1; Arp T1; KIAA0705; ARPT1; HSD27; MGC26590
• Gene ID: 139741
• mRNA Refseq: NM_138289
• Protein Refseq: NP_612146
• MIM: 300487
• UniProt ID: Q8TDG2