Recombinant Human ACTRT1 Protein, GST-tagged

Cat.No. : ACTRT1-243H
Product Overview : Human ACTRT1 partial ORF ( NP_612146.1, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein related to the cytoskeletal protein beta-actin. This protein is a major component of the calyx in the perinuclear theca of mammalian sperm heads, and it therefore likely functions in spermatid formation. This gene is intronless and is similar to a related gene located on chromosome 1. A related pseudogene has also been identified approximately 75 kb downstream of this gene on chromosome X. [provided by RefSeq, May 2010]
Molecular Mass : 36.74 kDa
AA Sequence : MFNPHALDVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQKYFVGQEALYKYEALHLHYPIERGLVTGWDDMEKLWKHLFERELGVK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACTRT1 actin-related protein T1 [ Homo sapiens ]
Official Symbol ACTRT1
Synonyms ACTRT1; actin-related protein T1; AIP1; ARIP1; Arp T1; KIAA0705; ARPT1; HSD27; MGC26590;
Gene ID 139741
mRNA Refseq NM_138289
Protein Refseq NP_612146
MIM 300487
UniProt ID Q8TDG2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACTRT1 Products

Required fields are marked with *

My Review for All ACTRT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon