Recombinant Human ACTR3 Protein, GST-tagged

• Cat.No.: ACTR3-237H
• Product Overview: Human ACTR3 full-length ORF ( AAH44590, 1 a.a. - 418 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The specific function of this gene has not yet been determined; however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Mar 2013]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 71.72 kDa
• AA Sequence: MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIAEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACTR3 ARP3 actin-related protein 3 homolog (yeast) [ Homo sapiens ]
• Official Symbol: ACTR3
• Synonyms: ACTR3; ARP3 actin-related protein 3 homolog (yeast); ARP3 (actin related protein 3, yeast) homolog; actin-related protein 3; ARP3; actin-like protein 3
• Gene ID: 10096
• mRNA Refseq: NM_005721
• Protein Refseq: NP_005712
• MIM: 604222
• UniProt ID: P61158