Recombinant Human ACTR1B Protein, GST-tagged

• Cat.No.: ACTR1B-235H
• Product Overview: Human ACTR1B partial ORF (NP_005726.1, 191 a.a. - 285 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Description: This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex. [provided by RefSeq, Aug 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.08 kDa
• AA Sequence: SRYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEALETEKVQYTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Protein length: 191-285 a.a.

Gene Information

• Gene Name: ACTR1B ARP1 actin-related protein 1 homolog B, centractin beta (yeast) [ Homo sapiens ]
• Official Symbol: ACTR1B
• Synonyms: ACTR1B; ARP1 actin-related protein 1 homolog B, centractin beta (yeast); ARP1 (actin related protein 1, yeast) homolog B (centractin beta) , CTRN2; beta-centractin; centractin beta; actin-related protein 1B; PC3; ARP1B; CTRN2
• Gene ID: 10120
• mRNA Refseq: NM_005735
• Protein Refseq: NP_005726
• MIM: 605144
• UniProt ID: P42025