Recombinant Human ACTL7B Protein, GST-tagged
Cat.No. : | ACTL7B-226H |
Product Overview : | Human ACTL7B partial ORF ( NP_006677, 286 a.a. - 377 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7B), and related gene, ACTL7A, are intronless, and are located approximately 4 kb apart in a head-to-head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 35.86 kDa |
AA Sequence : | GKLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMAANVLLCGGCTMLDGFPERFQRELSLLCPGDSPAVAAAPERK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACTL7B actin-like 7B [ Homo sapiens ] |
Official Symbol | ACTL7B |
Synonyms | ACTL7B; actin-like 7B; actin-like protein 7B; Tact1; actin-like 7-beta; actin-like-7-beta; |
Gene ID | 10880 |
mRNA Refseq | NM_006686 |
Protein Refseq | NP_006677 |
MIM | 604304 |
UniProt ID | Q9Y614 |
◆ Recombinant Proteins | ||
ACTL7B-1247M | Recombinant Mouse ACTL7B Protein | +Inquiry |
ACTL7B-226H | Recombinant Human ACTL7B Protein, GST-tagged | +Inquiry |
ACTL7B-288M | Recombinant Mouse ACTL7B Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTL7B-140R | Recombinant Rat ACTL7B Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTL7B-225H | Recombinant Human ACTL7B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTL7B-9058HCL | Recombinant Human ACTL7B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACTL7B Products
Required fields are marked with *
My Review for All ACTL7B Products
Required fields are marked with *
0
Inquiry Basket