Recombinant Human ACTL7A
Cat.No. : | ACTL7A-26590TH |
Product Overview : | Recombinant full length Human ACTL7A expressed in Saccharomyces cerevisiae; amino acids 1-435, 48.6kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 1-435 a.a. |
Description : | The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7A), and related gene, ACTL7B, are intronless, and are located approximately 4 kb apart in a head-to-head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7A gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. The ACTL7A gene is expressed in a wide variety of adult tissues, however, its exact function is not known. |
Form : | Liquid |
Purity : | Immunogen affinity purified |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRDGPAKR AVWVRHTSSEPQEPTESKAAKERPKQEVTKAVVVDLGT GYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKET FVGQELNNTNVHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFEAFNTP AMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEG YPLPSITGRLDYAGSDLTAYLLGLLNSAGNEFTQDQMG IVEDIKKKCCFVALDPIEEKKVPLSEHTIRYVLPDGKEIQ LCQERFLCSEMFFKPSLIKSMQLGLHTQTVSCLNKCDI ALKRDLMGNILLCGGSTMLSGFPNRLQKELSSMCPNDT PQVNVLPERDSAVWTGGSILASLQGFQPLWVHRFEYEE HGPFFLYRRCF |
Full Length : | Full L. |
Gene Name | ACTL7A actin-like 7A [ Homo sapiens ] |
Official Symbol | ACTL7A |
Synonyms | ACTL7A; actin-like 7A; actin-like protein 7A; |
Gene ID | 10881 |
mRNA Refseq | NM_006687 |
Protein Refseq | NP_006678 |
MIM | 604303 |
Uniprot ID | Q9Y615 |
Chromosome Location | 9q31 |
Function | structural constituent of cytoskeleton; |
◆ Recombinant Proteins | ||
ACTL7A-847HF | Recombinant Full Length Human ACTL7A Protein, GST-tagged | +Inquiry |
ACTL7A-139R | Recombinant Rat ACTL7A Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTL7A-20C | Recombinant Cynomolgus Monkey ACTL7A Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTL7A-224H | Recombinant Human ACTL7A Protein, GST-tagged | +Inquiry |
ACTL7A-270C | Recombinant Cynomolgus ACTL7A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTL7A-9059HCL | Recombinant Human ACTL7A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACTL7A Products
Required fields are marked with *
My Review for All ACTL7A Products
Required fields are marked with *
0
Inquiry Basket