Recombinant Human ACTL6B protein, His-Flag-tagged

• Cat.No.: ACTL6B-5324H
• Product Overview: Recombinant Human ACTL6B protein(O94805)(1-426aa), fused with C-terminal His-Flag tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: C-His-Flag
• Protein length: 1-426aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 48.8 kDa
• AASequence: MSGGVYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKEKLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERLRIPEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKCP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: ACTL6B actin-like 6B [ Homo sapiens ]
• Official Symbol: ACTL6B
• Synonyms: ACTL6B; actin-like 6B; actin like 6 , ACTL6; actin-like protein 6B; BAF53B; arpNalpha; hArpN alpha; actin-like 6; BRG1-associated factor 53B; actin-related protein Baf53b; 53 kDa BRG1-associated factor B; ACTL6
• Gene ID: 51412
• mRNA Refseq: NM_016188
• Protein Refseq: NP_057272
• MIM: 612458
• UniProt ID: O94805