Recombinant Human ACTL6B protein, His-Flag-tagged
Cat.No. : | ACTL6B-5324H |
Product Overview : | Recombinant Human ACTL6B protein(O94805)(1-426aa), fused with C-terminal His-Flag tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Flag&His |
Protein Length : | 1-426aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 48.8 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MSGGVYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKEKLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERLRIPEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKCP |
Gene Name | ACTL6B actin-like 6B [ Homo sapiens ] |
Official Symbol | ACTL6B |
Synonyms | ACTL6B; actin-like 6B; actin like 6 , ACTL6; actin-like protein 6B; BAF53B; arpNalpha; hArpN alpha; actin-like 6; BRG1-associated factor 53B; actin-related protein Baf53b; 53 kDa BRG1-associated factor B; ACTL6; |
Gene ID | 51412 |
mRNA Refseq | NM_016188 |
Protein Refseq | NP_057272 |
MIM | 612458 |
UniProt ID | O94805 |
◆ Recombinant Proteins | ||
Actl6b-3101R | Recombinant Rat Actl6b, His-tagged | +Inquiry |
ACTL6B-138R | Recombinant Rat ACTL6B Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTL6B-2883Z | Recombinant Zebrafish ACTL6B | +Inquiry |
ACTL6B-846HF | Recombinant Full Length Human ACTL6B Protein, GST-tagged | +Inquiry |
ACTL6B-223H | Recombinant Human ACTL6B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTL6B-9060HCL | Recombinant Human ACTL6B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACTL6B Products
Required fields are marked with *
My Review for All ACTL6B Products
Required fields are marked with *
0
Inquiry Basket