Recombinant Human ACTL6B, His-tagged

• Cat.No.: ACTL6B-26300TH
• Product Overview: Recombinant fragment, corresponding to amino acids 5-282 of Human BAF53b with an N terminal His tag. Predicted mwt: 32 kDa

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 5-282 a.a.
• Description: The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene encodes a subunit of the BAF (BRG1/brm-associated factor) complex in mammals, which is functionally related to SWI/SNF complex in S. cerevisiae and Drosophila; the latter is thought to facilitate transcriptional activation of specific genes by antagonizing chromatin-mediated transcriptional repression. This subunit may be involved in the regulation of genes by structural modulation of their chromatin, specifically in the brain.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 90 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLL AAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVM SPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEA PWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANG RSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDF ISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKE KLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVA AQMPTV

Gene Information

• Gene Name: ACTL6B actin-like 6B [ Homo sapiens ]
• Official Symbol: ACTL6B
• Synonyms: ACTL6B; actin-like 6B; actin like 6 , ACTL6; actin-like protein 6B; BAF53B
• Gene ID: 51412
• mRNA Refseq: NM_016188
• Protein Refseq: NP_057272
• MIM: 612458
• Uniprot ID: O94805
• Chromosome Location: 7q22
• Function: ATP binding; structural constituent of cytoskeleton; transcription coactivator activity