Recombinant Human ACTA2 protein, GST-tagged

• Cat.No.: ACTA2-7155H
• Product Overview: Recombinant Human ACTA2 protein(1-50 aa), fused with GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-50 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ACTA2 actin, alpha 2, smooth muscle, aorta [ Homo sapiens ]
• Official Symbol: ACTA2
• Synonyms: ACTA2; actin, alpha 2, smooth muscle, aorta; actin, aortic smooth muscle; ACTSA; alpha 2 actin; alpha-actin-2; alpha-cardiac actin; growth-inhibiting gene 46; cell growth-inhibiting gene 46 protein; AAT6; MYMY5
• Gene ID: 59
• mRNA Refseq: NM_001141945
• Protein Refseq: NP_001135417
• MIM: 102620
• UniProt ID: P62736