Recombinant Human ACSL3 Protein, GST-tagged
Cat.No. : | ACSL3-197H |
Product Overview : | Human ACSL3 partial ORF ( NP_004448, 203 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 35.2 kDa |
AA Sequence : | NETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDIAVIMYTS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACSL3 acyl-CoA synthetase long-chain family member 3 [ Homo sapiens ] |
Official Symbol | ACSL3 |
Synonyms | ACSL3; acyl-CoA synthetase long-chain family member 3; FACL3, fatty acid Coenzyme A ligase, long chain 3; long-chain-fatty-acid--CoA ligase 3; ACS3; PRO2194; LACS 3; lignoceroyl-CoA synthase; long-chain acyl-CoA synthetase 3; fatty-acid-Coenzyme A ligase, long-chain 3; FACL3; |
Gene ID | 2181 |
mRNA Refseq | NM_004457 |
Protein Refseq | NP_004448 |
MIM | 602371 |
UniProt ID | O95573 |
◆ Recombinant Proteins | ||
ACVR2B-4633H | Recombinant Human ACVR2B protein, His-tagged | +Inquiry |
Acsl3-9319M | Recombinant Mouse Acsl3, GST-tagged | +Inquiry |
ACSL3-1483H | Recombinant Human ACSL3 Protein, Myc/DDK-tagged | +Inquiry |
ACSL3-789HF | Recombinant Full Length Human ACSL3 Protein, GST-tagged | +Inquiry |
ACSL3-196H | Recombinant Human ACSL3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSL3-9077HCL | Recombinant Human ACSL3 293 Cell Lysate | +Inquiry |
ACSL3-9076HCL | Recombinant Human ACSL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACSL3 Products
Required fields are marked with *
My Review for All ACSL3 Products
Required fields are marked with *
0
Inquiry Basket