Recombinant Human ACSL1

• Cat.No.: ACSL1-26479TH
• Product Overview: Recombinant fragment: PKPLKPPCDL SMQSVEVAGS GGARRSALLD SDEPLVYFYD DVTTLYEGFQ RGIQVSNNGP CLGSRKPDQP YEWLSYKQVA ELSECIGSAL IQKGFKTA of Human ACSL1 (amino acids 48-145) with N terminal proprietary tag, 36.41 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 98 amino acids
• Description: The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.
• Molecular Weight: 36.410kDa inclusive of tags
• Tissue specificity: Highly expressed in liver, heart, skeletal muscle, kidney and erythroid cells, and to a lesser extent in brain, lung, placenta and pancreas.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA
• Sequence Similarities: Belongs to the ATP-dependent AMP-binding enzyme family.

Gene Information

• Gene Name: ACSL1 acyl-CoA synthetase long-chain family member 1 [ Homo sapiens ]
• Official Symbol: ACSL1
• Synonyms: ACSL1; acyl-CoA synthetase long-chain family member 1; FACL2, fatty acid Coenzyme A ligase, long chain 2; long-chain-fatty-acid--CoA ligase 1; ACS1; FACL1; LACS; LACS1; LACS2; lignoceroyl CoA synthase; long chain fatty acid coenzyme A ligase 1
• Gene ID: 2180
• mRNA Refseq: NM_001995
• Protein Refseq: NP_001986
• MIM: 152425
• Uniprot ID: P33121
• Chromosome Location: 4q35
• Pathway: Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Fatty Acid Beta Oxidation, organism-specific biosystem; Fatty Acid Biosynthesis, organism-specific biosystem; Fatty Acyl-CoA Biosynthesis, organism-specific biosystem
• Function: ATP binding; ligase activity; long-chain fatty acid-CoA ligase activity; nucleotide binding