Recombinant Human ACSBG1 protein, His-tagged

• Cat.No.: ACSBG1-3948H
• Product Overview: Recombinant Human ACSBG1 protein(404-686 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 404-686 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: AMSVTLEQNLTCPGSDLKPFTTRLADYLVLAKVRQALGFAKCQKNFYGAAPMMAETQHFFLGLNIRLYAGYGLSETSGPHFMSSPYNYRLYSSGKLVPGCRVKLVNQDAEGIGEICLWGRTIFMGYLNMEDKTCEAIDEEGWLHTGDAGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISNAMLIGDQRKFLSMLLTLKCTLDPDTSDQTDNLTEQAVEFCQRVGSRATTVSEIIEKKDEAVYQAIEEGIRRVNMNAAARPYHIQKWAILE
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ACSBG1 acyl-CoA synthetase bubblegum family member 1 [ Homo sapiens ]
• Official Symbol: ACSBG1
• Synonyms: ACSBG1; acyl-CoA synthetase bubblegum family member 1; long-chain-fatty-acid--CoA ligase ACSBG1; BG1; BGM; bubblegum; FLJ30320; hBG1; hsBG; KIAA0631; lipidosin; MGC14352; very long chain acyl CoA synthetase; very long-chain acyl-CoA synthetase; BG; LPD; GR-LACS
• Gene ID: 23205
• mRNA Refseq: NM_001199377
• Protein Refseq: NP_001186306
• MIM: 614362
• UniProt ID: Q96GR2