Recombinant Human ACRC Protein, GST-Tagged

Cat.No. : ACRC-189H
Product Overview : Human ACRC partial ORF ( NP_443189.1, 592 a.a. - 691 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GCNA (Germ Cell Nuclear Acidic Peptidase) is a Protein Coding gene. Diseases associated with GCNA include Appendix Adenocarcinoma.
Molecular Mass : 36.74 kDa
AA Sequence : HEMCHAASWLIDGIHDSHGDAWKYYARKSNRIHPELPRVTRCHNYKINYKVHYECTGCKTRIGCYTKSLDTSRFICAKCKGSLVMVPLTQKDGTRIVPHV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACRC acidic repeat containing [ Homo sapiens ]
Official Symbol ACRC
Synonyms ACRC; acidic repeat containing; acidic repeat-containing protein; putative nuclear protein; NAAR1;
Gene ID 93953
mRNA Refseq NM_052957
Protein Refseq NP_443189
MIM 300369
UniProt ID Q96QF7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACRC Products

Required fields are marked with *

My Review for All ACRC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon