Recombinant Human ACPP protein, Arginine-tagged

Cat.No. : ACPP-150H
Product Overview : Recombinant human ACPP protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : KELKFVTLVFRHGDRSPIDTFPTDPIKESSWPQGFGQLTQLGMEQHYELGEYIRKRYRKFLNESYKHEQVYIRST DVDRTLMSAMTNLAALVPPEGVSIWNPILLWQPIPVHTVPLSEDQLLYLPFRNCPRFQELESETLKSEEFQKRLH PYKDFIATLGKLSGLHGQDLFGIWSKVYDPLYCESVHNFTLPSRATEDTMTKLRELSELSLLSLYGIHKQKEKSR LQGGVLVNEILNHMKRATQIPSYKKLIMYSAHDTTVSGLQMALDVYNGLLPPYASCHLTELYFEKGEYFVEMYYR NETQHEPYPLMLPGCSPSCPLERFAELVGPVIPQDWSTECMTTNSHQLEESGGGGSPGRRRRRRRRRRR
Purity : >90% by SDS-PAGE
Applications : 1. Human prostate specific tumor antigen.2. Immunogen for specific antibody production.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name ACPP acid phosphatase, prostate [ Homo sapiens ]
Official Symbol ACPP
Synonyms ACPP; acid phosphatase, prostate; prostatic acid phosphatase; ACP 3; ACP3; TMPase; 5-nucleotidase; ecto-5-nucleotidase; thiamine monophosphatase; PAP; 5-NT; ACP-3;
Gene ID 55
mRNA Refseq NM_001099
Protein Refseq NP_001090
MIM 171790
UniProt ID P15309
Chromosome Location 3q21-qter
Pathway Riboflavin metabolism, organism-specific biosystem; Riboflavin metabolism, conserved biosystem;
Function 5-nucleotidase activity; acid phosphatase activity; hydrolase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACPP Products

Required fields are marked with *

My Review for All ACPP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon