Recombinant Human ACP7 Protein, GST-tagged

Cat.No. : ACP7-4252H
Product Overview : Human FLJ16165 full-length ORF (BAD18425.1, 1 a.a. - 438 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Purple acid phosphatases (PAPs), including PAPL, are a family of binuclear metallohydrolases that have been identified in plants, animals, and fungi (Flanagan et al., 2006 [PubMed 16793224]).[supplied by OMIM
Molecular Mass : 76.9 kDa
AA Sequence : MHPLPGYWSCYCLLLLFSLGVQGSLGAPSAAPEQVHLSYPGEPGSMTVTWTTWVPTRSEVQFGLQPSGPLPLRAQGTFVPFVDGGILRRKLYIHRVTLRKLLPGVQYVYRCGSAQGWSRRFRFRALKNGAHWSPRLAVFGDLGADNPKAVPRLRRDTQQGMYDAVLHVGDFAYNLDQDNARVGDRFMRLIEPVAASLPYMTCPGNHEERYNFSNYKARFSMPGDNEGLWYSWDLGPAHIISFSTEVYFFLHYGRHLVQRQFRWLESDLQKANKNRAARPWIITMGHRPMYCSNADLDDCTRHESKVRKGLQGKLYGLEDLFYKYGVDLQLWAHEHSYERLWPIYNYQVFNGSREMPYTNPRGPVHIITGSAGCEERLTPFAVFPRPWSAVRVKEYGYTRLHILNGTHTHIQQVSDDQDGKIVDDVWVVRPLFGRRMYL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACP7 acid phosphatase 7, tartrate resistant (putative) [ Homo sapiens (human) ]
Official Symbol ACP7
Synonyms ACP7; acid phosphatase 7, tartrate resistant (putative); PAPL; PAPL1; acid phosphatase type 7; iron/zinc purple acid phosphatase-like protein; purple acid phosphatase long form 1; EC 3.1.3.2
Gene ID 390928
mRNA Refseq NM_001004318
Protein Refseq NP_001004318
MIM 610490
UniProt ID Q6ZNF0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACP7 Products

Required fields are marked with *

My Review for All ACP7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon