Recombinant Human ACP7 Protein, GST-tagged
Cat.No. : | ACP7-4252H |
Product Overview : | Human FLJ16165 full-length ORF (BAD18425.1, 1 a.a. - 438 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Purple acid phosphatases (PAPs), including PAPL, are a family of binuclear metallohydrolases that have been identified in plants, animals, and fungi (Flanagan et al., 2006 [PubMed 16793224]).[supplied by OMIM |
Molecular Mass : | 76.9 kDa |
AA Sequence : | MHPLPGYWSCYCLLLLFSLGVQGSLGAPSAAPEQVHLSYPGEPGSMTVTWTTWVPTRSEVQFGLQPSGPLPLRAQGTFVPFVDGGILRRKLYIHRVTLRKLLPGVQYVYRCGSAQGWSRRFRFRALKNGAHWSPRLAVFGDLGADNPKAVPRLRRDTQQGMYDAVLHVGDFAYNLDQDNARVGDRFMRLIEPVAASLPYMTCPGNHEERYNFSNYKARFSMPGDNEGLWYSWDLGPAHIISFSTEVYFFLHYGRHLVQRQFRWLESDLQKANKNRAARPWIITMGHRPMYCSNADLDDCTRHESKVRKGLQGKLYGLEDLFYKYGVDLQLWAHEHSYERLWPIYNYQVFNGSREMPYTNPRGPVHIITGSAGCEERLTPFAVFPRPWSAVRVKEYGYTRLHILNGTHTHIQQVSDDQDGKIVDDVWVVRPLFGRRMYL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACP7 acid phosphatase 7, tartrate resistant (putative) [ Homo sapiens (human) ] |
Official Symbol | ACP7 |
Synonyms | ACP7; acid phosphatase 7, tartrate resistant (putative); PAPL; PAPL1; acid phosphatase type 7; iron/zinc purple acid phosphatase-like protein; purple acid phosphatase long form 1; EC 3.1.3.2 |
Gene ID | 390928 |
mRNA Refseq | NM_001004318 |
Protein Refseq | NP_001004318 |
MIM | 610490 |
UniProt ID | Q6ZNF0 |
◆ Recombinant Proteins | ||
RFL-27313MF | Recombinant Full Length Macaca Mulatta Apelin Receptor(Aplnr) Protein, His-Tagged | +Inquiry |
IL21-3039R | Recombinant Rat IL21 Protein | +Inquiry |
Mettl21a-4044M | Recombinant Mouse Mettl21a Protein, Myc/DDK-tagged | +Inquiry |
RAB27A-4882R | Recombinant Rat RAB27A Protein | +Inquiry |
Sgo1-5827M | Recombinant Mouse Sgo1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Serpinc1-298M | Active Native Mouse Antithrombin III | +Inquiry |
Lectin-1767D | Active Native Datura Stramonium Lectin Protein, Fluorescein labeled | +Inquiry |
Acta1-158M | Native Mouse skeletal muscle alpha Actin | +Inquiry |
ALB-37G | Native Goat Albumin (ALB) Protein | +Inquiry |
PRTN3-243H | Native Human PRTN3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Colon-85R | Rhesus monkey Colon Lysate | +Inquiry |
DAND5-7080HCL | Recombinant Human DAND5 293 Cell Lysate | +Inquiry |
Stomach-147R | Rat Stomach Tissue Lysate | +Inquiry |
OSBPL10-3542HCL | Recombinant Human OSBPL10 293 Cell Lysate | +Inquiry |
DCAF7-7055HCL | Recombinant Human DCAF7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ACP7 Products
Required fields are marked with *
My Review for All ACP7 Products
Required fields are marked with *
0
Inquiry Basket