Recombinant Human ACP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ACP1-1123H |
Product Overview : | ACP1 MS Standard C13 and N15-labeled recombinant protein (NP_004291) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. |
Molecular Mass : | 17.9 kDa |
AA Sequence : | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNRVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ACP1 acid phosphatase 1 [ Homo sapiens (human) ] |
Official Symbol | ACP1 |
Synonyms | ACP1; acid phosphatase 1, soluble; low molecular weight phosphotyrosine protein phosphatase; LMW-PTP; LMW-PTPase; adipocyte acid phosphatase; red cell acid phosphatase 1; protein tyrosine phosphatase; acid phosphatase of erythrocyte; cytoplasmic phosphotyrosyl protein phosphatase; low molecular weight cytosolic acid phosphatase; HAAP; MGC3499; MGC111030; |
Gene ID | 52 |
mRNA Refseq | NM_004300 |
Protein Refseq | NP_004291 |
MIM | 171500 |
UniProt ID | P24666 |
◆ Recombinant Proteins | ||
ACP1-3351C | Recombinant Chicken ACP1 | +Inquiry |
ACP1-1068H | Active Recombinant Human ACP1 | +Inquiry |
ACP1-1146H | Recombinant Human ACP1 protein(Met1-His158), GST-tagged | +Inquiry |
ACP1-2477H | Recombinant Human ACP1 protein | +Inquiry |
ACP1-4837H | Recombinant Human ACP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACP1-9083HCL | Recombinant Human ACP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACP1 Products
Required fields are marked with *
My Review for All ACP1 Products
Required fields are marked with *
0
Inquiry Basket