Recombinant Human ACOT8 Protein, GST-Tagged

Cat.No. : ACOT8-170H
Product Overview : Human ACOT8 full-length ORF ( NP_005460.2, 1 a.a. - 319 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a peroxisomal thioesterase that appears to be involved more in the oxidation of fatty acids rather than in their formation. The encoded protein can bind to the human immunodeficiency virus-1 protein Nef, and mediate Nef-induced down-regulation of CD4 in T-cells. [provided by RefSeq, Oct 2010]
Molecular Mass : 62.3 kDa
AA Sequence : MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKLPVLYQVERTRTGSSFSVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYIGEGDMKMHCCVAAYISDYAFLGTALLPHQWQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRQDGVLAVTCAQEGVIRVKPQVSESKL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACOT8 acyl-CoA thioesterase 8 [ Homo sapiens ]
Official Symbol ACOT8
Synonyms ACOT8; acyl-CoA thioesterase 8; peroxisomal acyl CoA thioesterase , peroxisomal acyl CoA thioesterase 1 , PTE1; acyl-coenzyme A thioesterase 8; choloyl CoA hydrolase; hACTE III; hTE; PTE 2; thioesterase II; thioesterase III; choloyl-CoA hydrolase; palmitoyl-CoA hydrolase; choloyl-coenzyme A thioesterase; long-chain fatty-acyl-CoA hydrolase; peroxisomal acyl-CoA thioesterase 1; HIV-Nef associated acyl-CoA thioesterase; peroxisomal long-chain acyl-CoA thioesterase 1; peroxisomal acyl-coenzyme A thioester hydrolase 1; PTE1; PTE2; PTE-1; PTE-2; HNAACTE; hACTE-III;
Gene ID 10005
mRNA Refseq NM_005469
Protein Refseq NP_005460
MIM 608123
UniProt ID O14734

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACOT8 Products

Required fields are marked with *

My Review for All ACOT8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon