Recombinant Human ACOT8 Protein, GST-Tagged
Cat.No. : | ACOT8-170H |
Product Overview : | Human ACOT8 full-length ORF ( NP_005460.2, 1 a.a. - 319 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a peroxisomal thioesterase that appears to be involved more in the oxidation of fatty acids rather than in their formation. The encoded protein can bind to the human immunodeficiency virus-1 protein Nef, and mediate Nef-induced down-regulation of CD4 in T-cells. [provided by RefSeq, Oct 2010] |
Molecular Mass : | 62.3 kDa |
AA Sequence : | MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKLPVLYQVERTRTGSSFSVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYIGEGDMKMHCCVAAYISDYAFLGTALLPHQWQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRQDGVLAVTCAQEGVIRVKPQVSESKL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACOT8 acyl-CoA thioesterase 8 [ Homo sapiens ] |
Official Symbol | ACOT8 |
Synonyms | ACOT8; acyl-CoA thioesterase 8; peroxisomal acyl CoA thioesterase , peroxisomal acyl CoA thioesterase 1 , PTE1; acyl-coenzyme A thioesterase 8; choloyl CoA hydrolase; hACTE III; hTE; PTE 2; thioesterase II; thioesterase III; choloyl-CoA hydrolase; palmitoyl-CoA hydrolase; choloyl-coenzyme A thioesterase; long-chain fatty-acyl-CoA hydrolase; peroxisomal acyl-CoA thioesterase 1; HIV-Nef associated acyl-CoA thioesterase; peroxisomal long-chain acyl-CoA thioesterase 1; peroxisomal acyl-coenzyme A thioester hydrolase 1; PTE1; PTE2; PTE-1; PTE-2; HNAACTE; hACTE-III; |
Gene ID | 10005 |
mRNA Refseq | NM_005469 |
Protein Refseq | NP_005460 |
MIM | 608123 |
UniProt ID | O14734 |
◆ Recombinant Proteins | ||
ACOT8-1206M | Recombinant Mouse ACOT8 Protein | +Inquiry |
ACOT8-170H | Recombinant Human ACOT8 Protein, GST-Tagged | +Inquiry |
ACOT8-793HF | Recombinant Full Length Human ACOT8 Protein, GST-tagged | +Inquiry |
ACOT8-1581Z | Recombinant Zebrafish ACOT8 | +Inquiry |
ACOT8-3141H | Recombinant Human ACOT8, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACOT8-9086HCL | Recombinant Human ACOT8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACOT8 Products
Required fields are marked with *
My Review for All ACOT8 Products
Required fields are marked with *
0
Inquiry Basket