Recombinant Human ACOT8 Protein, GST-Tagged

• Cat.No.: ACOT8-170H
• Product Overview: Human ACOT8 full-length ORF ( NP_005460.2, 1 a.a. - 319 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a peroxisomal thioesterase that appears to be involved more in the oxidation of fatty acids rather than in their formation. The encoded protein can bind to the human immunodeficiency virus-1 protein Nef, and mediate Nef-induced down-regulation of CD4 in T-cells. [provided by RefSeq, Oct 2010]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 62.3 kDa
• AA Sequence: MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKLPVLYQVERTRTGSSFSVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYIGEGDMKMHCCVAAYISDYAFLGTALLPHQWQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRQDGVLAVTCAQEGVIRVKPQVSESKL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACOT8 acyl-CoA thioesterase 8 [ Homo sapiens ]
• Official Symbol: ACOT8
• Synonyms: ACOT8; acyl-CoA thioesterase 8; peroxisomal acyl CoA thioesterase , peroxisomal acyl CoA thioesterase 1 , PTE1; acyl-coenzyme A thioesterase 8; choloyl CoA hydrolase; hACTE III; hTE; PTE 2; thioesterase II; thioesterase III; choloyl-CoA hydrolase; palmitoyl-CoA hydrolase; choloyl-coenzyme A thioesterase; long-chain fatty-acyl-CoA hydrolase; peroxisomal acyl-CoA thioesterase 1; HIV-Nef associated acyl-CoA thioesterase; peroxisomal long-chain acyl-CoA thioesterase 1; peroxisomal acyl-coenzyme A thioester hydrolase 1; PTE1; PTE2; PTE-1; PTE-2; HNAACTE; hACTE-III
• Gene ID: 10005
• mRNA Refseq: NM_005469
• Protein Refseq: NP_005460
• MIM: 608123
• UniProt ID: O14734