Recombinant Human ACOT6 Protein, GST-Tagged

• Cat.No.: ACOT6-169H
• Product Overview: Human ACOT6 full-length ORF ( ADR82840.1, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ACOT6 (Acyl-CoA Thioesterase 6) is a Protein Coding gene. Among its related pathways are Metabolism and Fatty Acyl-CoA Biosynthesis. GO annotations related to this gene include carboxylic ester hydrolase activity. An important paralog of this gene is ACOT2.
• Molecular Mass: 22.8 kDa
• AA Sequence: MLQHPKVKGPSIALLGFSKGGDLCLSMASFLKGITATVLINACVANTVAPLHYKDMIIPKLVDDLGKVKITKSGFLTFMDTWSNPLEEHNHQSLVPLEKAQVPFLFIVGMDDQSWKSEFYAQIASERLQAHGKERPQIICYPETGHCIDPPYFPPSRASVHAVLGEAIFYGGEPKAHSKAQVDAWQQIQTFFHKHLNGKKSVKHSKI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACOT6 acyl-CoA thioesterase 6 [ Homo sapiens (human) ]
• Official Symbol: ACOT6
• Synonyms: ACOT6; acyl-CoA thioesterase 6; Acyl-CoA Thioesterase 6; Putative Acyl-CoA Thioesterase 6; C14orf42; Putative Acyl-Coenzyme A Thioesterase 6; Chromosome 14 Open Reading Frame 42; EC 3.1.2.2; EC 3.1.2.-; C14_5530; C14orf42; c14_5530; putative acyl-coenzyme A thioesterase 6; putative acyl-CoA thioesterase 6
• Gene ID: 641372
• mRNA Refseq: NM_001037162
• Protein Refseq: NP_001032239
• MIM: 614267
• UniProt ID: Q3I5F7