Recombinant Human ACMSD Protein, His-tagged

Cat.No. : ACMSD-10H
Product Overview : Recombinant Human ACMSD Protein(Q8TDX5)(Pro11-Leu330), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Pro11-Leu330
Form : Phosphate buffered saline
Storage : Store at -20 to -80°C.
Molecular Mass : 38 kDa
AA Sequence : PKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGL
Official Symbol ACMSD
Synonyms ACMSD; aminocarboxymuconate semialdehyde decarboxylase; 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; picolinate carboxylase;
Gene ID 130013
mRNA Refseq NM_138326
Protein Refseq NP_612199
MIM 608889
UniProt ID Q8TDX5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACMSD Products

Required fields are marked with *

My Review for All ACMSD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon