Recombinant Human ACMSD Protein, GST-Tagged

• Cat.No.: ACMSD-161H
• Product Overview: Human ACMSD partial ORF ( NP_612199, 179 a.a. - 278 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The neuronal excitotoxin quinolinate is an intermediate in the de novo synthesis pathway of NAD from tryptophan, and has been implicated in the pathogenesis of several neurodegenerative disorders. Quinolinate is derived from alpha-amino-beta-carboxy-muconate-epsilon-semialdehyde (ACMS). ACMSD (ACMS decarboxylase; EC 4.1.1.45) can divert ACMS to a benign catabolite and thus prevent the accumulation of quinolinate from ACMS.[supplied by OMIM, Oct 2004]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: SHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGLERKQFE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACMSD aminocarboxymuconate semialdehyde decarboxylase [ Homo sapiens ]
• Official Symbol: ACMSD
• Synonyms: ACMSD; aminocarboxymuconate semialdehyde decarboxylase; 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; picolinate carboxylase
• Gene ID: 130013
• mRNA Refseq: NM_138326
• Protein Refseq: NP_612199
• MIM: 608889
• UniProt ID: Q8TDX5