Recombinant Human ACCN5 Protein, GST-Tagged

• Cat.No.: ASIC5-153H
• Product Overview: Human ACCN5 full-length ORF ( AAI46498.1, 1 a.a. - 505 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known. [provided by RefSeq, Jul 2008]
• Molecular Mass: 61.2 kDa
• AA Sequence: MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ASIC5 acid sensing ion channel subunit family member 5 [ Homo sapiens (human) ]
• Official Symbol: ASIC5
• Synonyms: ASIC5; acid sensing ion channel subunit family member 5; Acid Sensing Ion Channel Subunit Family Member 5; Amiloride-Sensitive Cation Channel 5, Intestinal; Human Intestine Na(+) Channel; ACCN5; HINAC; Acid-Sensing (Proton-Gated) Ion Channel Family Member 5; Acid Sensing (Proton Gated) Ion Channel Family Member 5; Acid Sensing Ion Channel Family Member 5; Amiloride-Sensitive Cation Channel 5; Amiloride-Sensitive Sodium Channel; Acid-Sensing Ion Channel 5; INAC; acid-sensing ion channel 5; acid sensing (proton gated) ion channel family member 5; acid sensing ion channel family member 5; amiloride-sensitive cation channel 5, intestinal; amiloride-sensitive sodium channel; human intestine Na(+) channel
• Gene ID: 51802
• mRNA Refseq: NM_017419
• Protein Refseq: NP_059115
• MIM: 616693
• UniProt ID: Q9NY37