Recombinant Human ACBD6 Protein, GST-Tagged
Cat.No. : | ACBD6-150H |
Product Overview : | Human ACBD6 full-length ORF ( NP_115736.1, 1 a.a. - 282 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ACBD6 (Acyl-CoA Binding Domain Containing 6) is a Protein Coding gene. Among its related pathways are Metabolism and Fatty Acyl-CoA Biosynthesis. GO annotations related to this gene include lipid binding and fatty-acyl-CoA binding. |
Molecular Mass : | 61.2 kDa |
AA Sequence : | MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACBD6 acyl-CoA binding domain containing 6 [ Homo sapiens ] |
Official Symbol | ACBD6 |
Synonyms | ACBD6; acyl-CoA binding domain containing 6; acyl Coenzyme A binding domain containing 6; acyl-CoA-binding domain-containing protein 6; MGC2404; acyl-Coenzyme A binding domain containing 6; |
Gene ID | 84320 |
mRNA Refseq | NM_032360 |
Protein Refseq | NP_115736 |
UniProt ID | Q9BR61 |
◆ Recombinant Proteins | ||
ACBD6-2178H | Recombinant Human ACBD6 protein(Met1-Ala282), His-tagged | +Inquiry |
ACBD6-150H | Recombinant Human ACBD6 Protein, GST-Tagged | +Inquiry |
ACBD6-102R | Recombinant Rat ACBD6 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACBD6-765HF | Recombinant Full Length Human ACBD6 Protein, GST-tagged | +Inquiry |
ACBD6-1174M | Recombinant Mouse ACBD6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACBD6-688HCL | Recombinant Human ACBD6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACBD6 Products
Required fields are marked with *
My Review for All ACBD6 Products
Required fields are marked with *
0
Inquiry Basket