Recombinant Human ACBD4 Protein, GST-Tagged

• Cat.No.: ACBD4-148H
• Product Overview: Human ACBD4 full-length ORF ( NP_078998.1, 1 a.a. - 305 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]
• Molecular Mass: 61.2 kDa
• AA Sequence: MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACBD4 acyl-CoA binding domain containing 4 [ Homo sapiens ]
• Official Symbol: ACBD4
• Synonyms: ACBD4; acyl-CoA binding domain containing 4; acyl Coenzyme A binding domain containing 4; acyl-CoA-binding domain-containing protein 4; FLJ13322; acyl-Coenzyme A binding domain containing 4; HMFT0700; FLJ90623
• Gene ID: 79777
• mRNA Refseq: NM_001135704
• Protein Refseq: NP_001129176
• UniProt ID: Q8NC06