Recombinant Human ACBD4 Protein (1-305 aa), His-SUMO-tagged
Cat.No. : | ACBD4-1064H |
Product Overview : | Recombinant Human ACBD4 Protein (1-305 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Isoform 2. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-305 aa |
Description : | Binds medium- and long-chain acyl-CoA esters and may function as an intracellular carrier of acyl-CoA esters. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 50.8 kDa |
AA Sequence : | MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | ACBD4 acyl-CoA binding domain containing 4 [ Homo sapiens ] |
Official Symbol | ACBD4 |
Synonyms | ACBD4; FLJ13322; HMFT0700; FLJ90623; |
Gene ID | 79777 |
mRNA Refseq | NM_001135704 |
Protein Refseq | NP_001129176 |
UniProt ID | Q8NC06 |
◆ Recombinant Proteins | ||
ACBD4-5039H | Recombinant Human ACBD4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACBD4-100R | Recombinant Rat ACBD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACBD4-445R | Recombinant Rat ACBD4 Protein | +Inquiry |
ACBD4-12321Z | Recombinant Zebrafish ACBD4 | +Inquiry |
ACBD4-148H | Recombinant Human ACBD4 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACBD4-9106HCL | Recombinant Human ACBD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACBD4 Products
Required fields are marked with *
My Review for All ACBD4 Products
Required fields are marked with *
0
Inquiry Basket