Recombinant Human ACBD4 Protein (1-305 aa), His-SUMO-tagged

• Cat.No.: ACBD4-1064H
• Product Overview: Recombinant Human ACBD4 Protein (1-305 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Isoform 2.

Specification

• Description: Binds medium- and long-chain acyl-CoA esters and may function as an intracellular carrier of acyl-CoA esters.
• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 50.8 kDa
• Protein length: 1-305 aa
• AA Sequence: MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: ACBD4 acyl-CoA binding domain containing 4 [ Homo sapiens ]
• Official Symbol: ACBD4
• Synonyms: ACBD4; FLJ13322; HMFT0700; FLJ90623
• Gene ID: 79777
• mRNA Refseq: NM_001135704
• Protein Refseq: NP_001129176
• UniProt ID: Q8NC06