Recombinant Human ACBD3 Protein, GST-Tagged

Cat.No. : ACBD3-147H
Product Overview : Human ACBD3 partial ORF ( NP_073572, 73 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.63 kDa
AA Sequence : RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACBD3 acyl-CoA binding domain containing 3 [ Homo sapiens ]
Official Symbol ACBD3
Synonyms ACBD3; acyl-CoA binding domain containing 3; acyl Coenzyme A binding domain containing 3 , GOCAP1, golgi complex associated protein 1, 60kDa , GOLPH1; Golgi resident protein GCP60; GCP60; PAP7; PBR and PKA associated protein 7; golgi phosphoprotein 1; PKA (RIalpha)-associated protein; PBR- and PKA-associated protein 7; golgi complex associated protein 1, 60kDa; acyl-Coenzyme A binding domain containing 3; peripheral benzodiazepine receptor-associated protein PAP7; GOCAP1; GOLPH1;
Gene ID 64746
mRNA Refseq NM_022735
Protein Refseq NP_073572
MIM 606809
UniProt ID Q9H3P7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACBD3 Products

Required fields are marked with *

My Review for All ACBD3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon