Recombinant Human ACAP1 protein, His-tagged

Cat.No. : ACAP1-7343H
Product Overview : Recombinant Human ACAP1 protein(163-270 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 163-270 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : RAGYRGRALDYALQINVIEDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEG
Gene Name ACAP1 ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 [ Homo sapiens ]
Official Symbol ACAP1
Synonyms ACAP1; ArfGAP with coiled-coil, ankyrin repeat and PH domains 1; centaurin, beta 1 , CENTB1; arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1; KIAA0050; cnt-b1; centaurin-beta-1; centaurin, beta 1; Arf GAP with coiled coil, ANK repeat and PH domains 1; CENTB1;
Gene ID 9744
mRNA Refseq NM_014716
Protein Refseq NP_055531
MIM 607763
UniProt ID Q15027

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AIF Products

Required fields are marked with *

My Review for All AIF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon