Recombinant Human ACAD11 Protein, GST-tagged
Cat.No. : | ACAD11-4239H |
Product Overview : | Human FLJ12592 partial ORF ( NP_115545, 678 a.a. - 780 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an acyl-CoA dehydrogenase enzyme with a preference for carbon chain lengths between 20 and 26. Naturally occurring read-through transcription occurs between the upstream gene NPHP3 (nephronophthisis 3 (adolescent)) and this gene. [provided by RefSeq, Aug 2015] |
Molecular Mass : | 37.07 kDa |
AA Sequence : | RIAIEKIRLLTLKAAHSMDTLGSAGAKKEIAMIKVAAPRAVSKIVDWAIQVCGGAGVSQDYPLANMYAITRVLRLADGPDEVHLSAIATMELRDQAKRLTAKI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACAD11 acyl-CoA dehydrogenase family, member 11 [ Homo sapiens ] |
Official Symbol | ACAD11 |
Synonyms | ACAD11; acyl-CoA dehydrogenase family, member 11; acyl Coenzyme A dehydrogenase family, member 11; acyl-CoA dehydrogenase family member 11; FLJ12592; 62113 protein; acyl-Coenzyme A dehydrogenase family, member 11; ACAD-11; MGC150619; |
Gene ID | 84129 |
mRNA Refseq | NM_032169 |
Protein Refseq | NP_115545 |
MIM | 614288 |
UniProt ID | Q709F0 |
◆ Recombinant Proteins | ||
ACAD11-91R | Recombinant Rat ACAD11 Protein, His (Fc)-Avi-tagged | +Inquiry |
Acad11-217M | Recombinant Mouse Acad11 Protein, MYC/DDK-tagged | +Inquiry |
ACAD11-3858H | Recombinant Human ACAD11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACAD11-436R | Recombinant Rat ACAD11 Protein | +Inquiry |
ACAD11-4239H | Recombinant Human ACAD11 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACAD11-9117HCL | Recombinant Human ACAD11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACAD11 Products
Required fields are marked with *
My Review for All ACAD11 Products
Required fields are marked with *
0
Inquiry Basket