Recombinant Human ACACB Protein, GST-Tagged

• Cat.No.: ACACB-127H
• Product Overview: Human ACACB partial ORF ( NP_001084, 22 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. ACC-beta is thought to control fatty acid oxidation by means of the ability of malonyl-CoA to inhibit carnitine-palmitoyl-CoA transferase I, the rate-limiting step in fatty acid uptake and oxidation by mitochondria. ACC-beta may be involved in the regulation of fatty acid oxidation, rather than fatty acid biosynthesis. There is evidence for the presence of two ACC-beta isoforms. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: IWGKMTDSKPITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACACB acetyl-CoA carboxylase beta [ Homo sapiens ]
• Official Symbol: ACACB
• Synonyms: ACACB; acetyl-CoA carboxylase beta; acetyl Coenzyme A carboxylase beta; acetyl-CoA carboxylase 2; ACC2; ACCB; acetyl CoA carboxylase 2; HACC275; ACC-beta; acetyl-Coenzyme A carboxylase beta
• Gene ID: 32
• mRNA Refseq: NM_001093
• Protein Refseq: NP_001084
• MIM: 601557
• UniProt ID: O00763