Recombinant Human ACACB Protein, GST-Tagged

Cat.No. : ACACB-127H
Product Overview : Human ACACB partial ORF ( NP_001084, 22 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. ACC-beta is thought to control fatty acid oxidation by means of the ability of malonyl-CoA to inhibit carnitine-palmitoyl-CoA transferase I, the rate-limiting step in fatty acid uptake and oxidation by mitochondria. ACC-beta may be involved in the regulation of fatty acid oxidation, rather than fatty acid biosynthesis. There is evidence for the presence of two ACC-beta isoforms. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.63 kDa
AA Sequence : IWGKMTDSKPITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACACB acetyl-CoA carboxylase beta [ Homo sapiens ]
Official Symbol ACACB
Synonyms ACACB; acetyl-CoA carboxylase beta; acetyl Coenzyme A carboxylase beta; acetyl-CoA carboxylase 2; ACC2; ACCB; acetyl CoA carboxylase 2; HACC275; ACC-beta; acetyl-Coenzyme A carboxylase beta;
Gene ID 32
mRNA Refseq NM_001093
Protein Refseq NP_001084
MIM 601557
UniProt ID O00763

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACACB Products

Required fields are marked with *

My Review for All ACACB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon