Recombinant Human ABR Protein, GST-Tagged

• Cat.No.: ABR-116H
• Product Overview: Human ABR partial ORF ( NP_068781, 750 a.a. - 859 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene. [provided by RefSeq, Feb 2012]
• Molecular Mass: 37.84 kDa
• AA Sequence: PAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISFAELKRNTLYFSTDV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ABR active BCR-related [ Homo sapiens ]
• Official Symbol: ABR
• Synonyms: ABR; active BCR-related; active BCR related gene; active breakpoint cluster region-related protein; MDB; FLJ45954
• Gene ID: 29
• mRNA Refseq: NM_001092
• Protein Refseq: NP_001083
• MIM: 600365
• UniProt ID: Q12979