Recombinant Human ABR Protein, GST-Tagged
Cat.No. : | ABR-116H |
Product Overview : | Human ABR partial ORF ( NP_068781, 750 a.a. - 859 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene. [provided by RefSeq, Feb 2012] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | PAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISFAELKRNTLYFSTDV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABR active BCR-related [ Homo sapiens ] |
Official Symbol | ABR |
Synonyms | ABR; active BCR-related; active BCR related gene; active breakpoint cluster region-related protein; MDB; FLJ45954; |
Gene ID | 29 |
mRNA Refseq | NM_001092 |
Protein Refseq | NP_001083 |
MIM | 600365 |
UniProt ID | Q12979 |
◆ Recombinant Proteins | ||
ABR-116H | Recombinant Human ABR Protein, GST-Tagged | +Inquiry |
Abr-445M | Recombinant Mouse Abr Protein, MYC/DDK-tagged | +Inquiry |
ABR-115H | Recombinant Human ABR Protein, GST-Tagged | +Inquiry |
ABR-301435H | Recombinant Human ABR protein, GST-tagged | +Inquiry |
ABR-3116B | Recombinant Bovine ABR, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABR-9122HCL | Recombinant Human ABR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABR Products
Required fields are marked with *
My Review for All ABR Products
Required fields are marked with *
0
Inquiry Basket