Recombinant Human ABO Protein (AA 65-354), N-6×His/GFP tagged

Description :	This gene encodes proteins related to the first discovered blood group system, ABO. Variation in the ABO gene (chromosome 9q34.2) is the basis of the ABO blood group, thus the presence of an allele determines the blood group in an individual. The 'O' blood group is caused by a deletion of guanine-258 near the N-terminus of the protein which results in a frameshift and translation of an almost entirely different protein. Individuals with the A, B, and AB alleles express glycosyltransferase activities that convert the H antigen into the A or B antigen. Other minor alleles have been found for this gene.
Source :	HEK293
Species :	Human
Tag :	His&GFP
Molecular Mass :	~66 kDa
Protein length :	AA 65-354
AA Sequence :	SLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
Purity :	>95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain.
Stability :	6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
Concentration :	1 mg/mL
Storage Buffer :	Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
Preservative :	0.05 % NaN3
Shipping :	This product is shipped as 0.2μm filtered product on dry ice.

Gene Name	ABO ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase) [ Homo sapiens (human) ]
Official Symbol	ABO
Synonyms	ABO; ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase); histo-blood group ABO system transferase; A3GALNT; A3GALT1; ABO glycosyltransferase; histo-blood group A transferase; histo-blood group B transferase; histo-blood group A2 transferase; B(A) alpha-1,3-galactosyltransferase; fucosylglycoprotein 3-alpha-galactosyltransferase; fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase; glycoprotein-fucosylgalactoside alpha-galactosyltransferase; glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase; GTB; NAGAT;
Gene ID	28
mRNA Refseq	NM_020469
Protein Refseq	NP_065202
MIM	110300
UniProt ID	P16442

ACE2-735H	Recombinant Human ACE2 Protein, His-tagged	+Inquiry
FGF10-15H	Active Recombinant Human FGF10 protein	+Inquiry
KITLG-19H	Active Recombinant Human KITLG Protein, Pre-aliquoted	+Inquiry
DEFB1-17H	Active Recombinant Human DEFB1 protein(1-47aa)	+Inquiry
DEFB4-18H	Active Recombinant Human DEFB4 protein(1-50aa)	+Inquiry