Recombinant Human ABO Protein (AA 65-354), N-6×His/GFP tagged

Cat.No. : ABO-29H
Product Overview : Recombinant Human ABO Protein (AA 65-354) with N-6×His/GFP tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : GFP&His
Protein Length : AA 65-354
Description : This gene encodes proteins related to the first discovered blood group system, ABO. Variation in the ABO gene (chromosome 9q34.2) is the basis of the ABO blood group, thus the presence of an allele determines the blood group in an individual. The 'O' blood group is caused by a deletion of guanine-258 near the N-terminus of the protein which results in a frameshift and translation of an almost entirely different protein. Individuals with the A, B, and AB alleles express glycosyltransferase activities that convert the H antigen into the A or B antigen. Other minor alleles have been found for this gene.
Molecular Mass : ~66 kDa
AA Sequence : SLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
Purity : >95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain.
Stability : 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
Concentration : 1 mg/mL
Storage Buffer : Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
Preservative : 0.05 % NaN3
Shipping : This product is shipped as 0.2μm filtered product on dry ice.
Gene Name ABO ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase) [ Homo sapiens (human) ]
Official Symbol ABO
Synonyms ABO; ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase); histo-blood group ABO system transferase; A3GALNT; A3GALT1; ABO glycosyltransferase; histo-blood group A transferase; histo-blood group B transferase; histo-blood group A2 transferase; B(A) alpha-1,3-galactosyltransferase; fucosylglycoprotein 3-alpha-galactosyltransferase; fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase; glycoprotein-fucosylgalactoside alpha-galactosyltransferase; glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase; GTB; NAGAT;
Gene ID 28
mRNA Refseq NM_020469
Protein Refseq NP_065202
MIM 110300
UniProt ID P16442

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ABO Products

Required fields are marked with *

My Review for All ABO Products

Required fields are marked with *

0

Inquiry Basket

cartIcon