Recombinant Human ABL1 protein(531-650 aa), C-His-tagged

• Cat.No.: ABL1-2499H
• Product Overview: Recombinant Human ABL1 protein(P00519)(531-650 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 531-650 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: KTRTSRRAAEHRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTP
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: ABL1 c-abl oncogene 1, non-receptor tyrosine kinase [ Homo sapiens ]
• Official Symbol: ABL1
• Synonyms: ABL1; c-abl oncogene 1, non-receptor tyrosine kinase; ABL, c abl oncogene 1, receptor tyrosine kinase , v abl Abelson murine leukemia viral oncogene homolog 1; tyrosine-protein kinase ABL1; c ABL; JTK7; p150; proto-oncogene c-Abl; bcr/c-abl oncogene protein; Abelson tyrosine-protein kinase 1; c-abl oncogene 1, receptor tyrosine kinase; proto-oncogene tyrosine-protein kinase ABL1; v-abl Abelson murine leukemia viral oncogene homolog 1; ABL; c-ABL; v-abl; bcr/abl
• Gene ID: 25
• mRNA Refseq: NM_005157
• Protein Refseq: NP_005148
• MIM: 189980
• UniProt ID: P00519