Recombinant Human ABHD2 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | ABHD2-301H |
Product Overview : | ABHD2 MS Standard C13 and N15-labeled recombinant protein (NP_008942) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein containing an alpha/beta hydrolase fold, which is a catalytic domain found in a wide range of enzymes. The encoded protein is an acylglycerol lipase that catalyzes the hydrolysis of endocannabinoid arachidonoylglycerol from the cell membrane. This leads to activation of the sperm calcium channel CatSper, which results in sperm activation. Alternative splicing of this gene results in two transcript variants encoding the same protein. [provided by RefSeq, Jan 2017] |
Molecular Mass : | 48.3 kDa |
AA Sequence : | MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCPLLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQLVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSALRAQETFMQWDQCQRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKLQCSDTEQVEADLETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ABHD2 abhydrolase domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | ABHD2 |
Synonyms | ABHD2; abhydrolase domain containing 2; abhydrolase domain-containing protein 2; LABH2; protein PHPS1-2; lung alpha/beta hydrolase 2; alpha/beta hydrolase domain containing protein 2; HS1-2; PHPS1-2; MGC26249; MGC111112; |
Gene ID | 11057 |
mRNA Refseq | NM_007011 |
Protein Refseq | NP_008942 |
MIM | 612196 |
UniProt ID | P08910 |
◆ Recombinant Proteins | ||
ABHD2-190R | Recombinant Rhesus monkey ABHD2 Protein, His-tagged | +Inquiry |
ABHD2-03H | Recombinant Human ABHD2 Protein, N-His6ABP-tagged | +Inquiry |
Abhd2-1471M | Recombinant Mouse Abhd2 Protein, Myc/DDK-tagged | +Inquiry |
ABHD2-248H | Recombinant Human ABHD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABHD2-02H | Recombinant Human ABHD2 Protein, C-Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABHD2-9135HCL | Recombinant Human ABHD2 293 Cell Lysate | +Inquiry |
ABHD2-9134HCL | Recombinant Human ABHD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABHD2 Products
Required fields are marked with *
My Review for All ABHD2 Products
Required fields are marked with *
0
Inquiry Basket