Recombinant Human ABHD2 Protein, His tagged

• Cat.No.: ABHD2-3040H
• Product Overview: Recombinant Human ABHD2 protein (31-425 aa) with His tag was expressed in E. coli.

Specification

• Description: This gene encodes a protein containing an alpha/beta hydrolase fold, which is a catalytic domain found in a wide range of enzymes. The encoded protein is an acylglycerol lipase that catalyzes the hydrolysis of endocannabinoid arachidonoylglycerol from the cell membrane. This leads to activation of the sperm calcium channel CatSper, which results in sperm activation. Alternative splicing of this gene results in two transcript variants encoding the same protein.
• Source: E. coli
• Species: Human
• Tag: C-His
• Protein length: 31-425 aa
• Molecular Mass: 46 kDa
• AA Sequence: MRCLNLKSPTAPPDLYFQDSGLSRFLLKSCPLLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQLVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSALRAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKLQCSDTEQVEADLEHHHHHH
• Purity: > 90 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: 20mM Tris, pH 8.0, 100mM NaCl, 10 % Glycerol, 0.1 % SKL
• Concentration: 0.38 mg/mL

Gene Information

• Gene Name: ABHD2 abhydrolase domain containing 2, acylglycerol lipase [ Homo sapiens (human) ]
• Official Symbol: ABHD2
• Synonyms: ABHD2; abhydrolase domain containing 2; abhydrolase domain-containing protein 2; LABH2; protein PHPS1-2; lung alpha/beta hydrolase 2; alpha/beta hydrolase domain containing protein 2; HS1-2; PHPS1-2; MGC26249; MGC111112
• Gene ID: 11057
• mRNA Refseq: NM_007011
• Protein Refseq: NP_008942
• MIM: 612196
• UniProt ID: P08910