Recombinant Human ABCG2 protein, His-Myc-tagged

• Cat.No.: ABCG2-045H
• Product Overview: Recombinant Human ABCG2 protein(Q9UNQ0)(557-630aa), fused with C-terminal 6xHis tag and Myc tag, was expressed in Yeast.

Specification

• Source: Yeast
• Species: Human
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 12.1 kDa
• Protein length: 557-630aa
• AA Sequence: NLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNH
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: ABCG2 ATP-binding cassette, sub-family G (WHITE), member 2 [ Homo sapiens ]
• Official Symbol: ABCG2
• Synonyms: ABCG2; ATP-binding cassette, sub-family G (WHITE), member 2; ATP-binding cassette sub-family G member 2; ABCP; BCRP; CD338; EST157481; MXR; ABC transporter; placenta specific MDR protein; breast cancer resistance protein; ATP-binding cassette transporter G2; mitoxantrone resistance-associated protein; placenta-specific ATP-binding cassette transporter; multi drug resistance efflux transport ATP-binding cassette sub-family G (WHITE) member 2; MRX; BMDP; MXR1; ABC15; BCRP1; GOUT1; CDw338; UAQTL1; MGC102821
• Gene ID: 9429
• mRNA Refseq: NM_001257386
• Protein Refseq: NP_001244315
• MIM: 603756
• UniProt ID: Q9UNQ0