Recombinant Human ABCC4 protein, His-tagged

Cat.No. : ABCC4-2453H
Product Overview : Recombinant Human ABCC4 protein(347-707 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : N-His
Protein length : 347-707 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AASequence : TASRVFVAVTLYGAVRLTVTLFFPSAIERVSEAIVSIRRIQTFLLLDEISQRNRQLPSDGKKMVHVQDFTAFWDKASETPTLQGLSFTVRPGELLAVVGPVGAGKSSLLSAVLGELAPSHGLVSVHGRIAYVSQQPWVFSGTLRSNILFGKKYEKERYEKVIKACALKKDLQLLEDGDLTVIGDRGTTLSGGQKARVNLARAVYQDADIYLLDDPLSAVDAEVSRHLFELCICQILHEKITILVTHQLQYLKAASQILILKDGKMVQKGTYTEFLKSGIDFGSLLKKDNEESEQPPVPGTPTLRNRTFSESSVWSQQSSRPSLKDGALESQDTENVPVTLSEENRSEGKVGFQAYKNYFRA
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
Gene Name ABCC4 ATP-binding cassette, sub-family C (CFTR/MRP), member 4 [ Homo sapiens ]
Official Symbol ABCC4
Synonyms ABCC4; ATP-binding cassette, sub-family C (CFTR/MRP), member 4; multidrug resistance-associated protein 4; bA464I2.1 (ATP binding cassette; sub family C (CFTR/MRP); member 4); canalicular multispecific organic anion transporter (ABC superfamily); EST170205; MOAT B; MOATB; MRP4; multidrug resistance associated protein 4; multispecific organic anion transporter B; MRP/cMOAT-related ABC transporter; ATP-binding cassette sub-family C member 4; multi-specific organic anion transporter B; bA464I2.1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 4); MOAT-B;
Gene ID 10257
mRNA Refseq NM_001105515
Protein Refseq NP_001098985
MIM 605250
UniProt ID O15439

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ADRA1B Products

Required fields are marked with *

My Review for All ADRA1B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon