Recombinant Human ABCC3 protein(871-950 aa), C-His-tagged

• Cat.No.: ABCC3-2466H
• Product Overview: Recombinant Human ABCC3 protein(O15438)(871-950 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 871-950 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: AEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAA

Gene Information

• Gene Name: ABCC3 ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [ Homo sapiens ]
• Official Symbol: ABCC3
• Synonyms: ABCC3; ATP-binding cassette, sub-family C (CFTR/MRP), member 3; canalicular multispecific organic anion transporter 2; cMOAT2; EST90757; MLP2; MOAT D; MRP3; multidrug resistance associated protein; multidrug resistance-associated protein 3; ATP-binding cassette sub-family C member 3; multi-specific organic anion transporter D; canicular multispecific organic anion transporter; ABC31; MOAT-D
• Gene ID: 8714
• mRNA Refseq: NM_001144070
• Protein Refseq: NP_001137542
• MIM: 604323
• UniProt ID: O15438